PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591685.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 327aa    MW: 37077 Da    PI: 4.8317
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591685.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.5e-1993146356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++t++q++ Le+ F +++++  e++ +LAk+lgL+ rq+ +WFqNrRa++k
  XP_009591685.1  93 KKRRLTENQVQFLEKSFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWK 146
                     56689************************************************9 PP

2HD-ZIP_I/II129.41.4e-4192183192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekkrrl+++qv++LE+sF ee+kLeperKv+la+eLglqprq+a+WFqnrRAR+ktkqlEk+yeaL+++yd+lk++ ++L ke+e+Lr+e+ 
  XP_009591685.1  92 EKKRRLTENQVQFLEKSFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWKTKQLEKEYEALRNQYDNLKSDYNNLLKEKENLRAEVF 183
                     69**************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.06E-1983150IPR009057Homeodomain-like
PROSITE profilePS5007117.58988148IPR001356Homeobox domain
SMARTSM003892.0E-1891152IPR001356Homeobox domain
CDDcd000861.85E-1793149No hitNo description
PfamPF000461.7E-1693146IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-1998147IPR009057Homeodomain-like
PRINTSPR000316.4E-6119128IPR000047Helix-turn-helix motif
PROSITE patternPS000270123146IPR017970Homeobox, conserved site
PRINTSPR000316.4E-6128144IPR000047Helix-turn-helix motif
PfamPF021833.4E-14148189IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MMAPGMLYSA GACASNFDGV LIQKQRVMSS SSSTAKEHLG SLFVPGCSSS YLGSSSMVSF  60
GSVNGGKRSF FDSFDQEENE ADELGEYFHQ AEKKRRLTEN QVQFLEKSFG EENKLEPERK  120
VQLAKELGLQ PRQIAIWFQN RRARWKTKQL EKEYEALRNQ YDNLKSDYNN LLKEKENLRA  180
EVFQLNDKLL LNEKENGQLT QRDFQKHSDS SPKETMADPI SRVKMSNVSA RVLKEDLSSA  240
KSDVLGSESP HYTDGVHSSF VKQGDSYVVE PEPSDLSQDD EENFNKTMLS TANLLAKAED  300
DDYRVTSSNV SYFGFPVEDQ GFGFWSY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140148RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-122HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591685.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLM1CDJ81e-180M1CDJ8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000652071e-179(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.15e-39homeobox 1